SCOPe 2.03: Domain d3hbpa1: 3hbp A:94-343

Lineage for d3hbpa1 (3hbp A:94-343)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.176: Oxidoreductase molybdopterin-binding domain [56523] (1 superfamily)
   unusual fold; contains 3 layers of beta-sheet structure and a beta-grasp like motif

4. Superfamily d.176.1: Oxidoreductase molybdopterin-binding domain [56524] (2 families)

5. Family d.176.1.0: automated matches [227253] (1 protein)
   not a true family

6. Protein automated matches [227034] (1 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [225869] (6 PDB entries)

8. Domain d3hbpa1: 3hbp A:94-343 [210978]
   Other proteins in same PDB: d3hbpa2
   automated match to d1ogpa2
   complexed with mom, mte, so3; mutant

Details for d3hbpa1

PDB Entry: 3hbp, 2.4 Å

PDB Description: the crystal structure of c185s mutant of recombinant sulfite oxidase with bound substrate, sulfite, at the active site

PDB Compounds: (A:) Sulfite Oxidase mutant C185S

SCOPe Domain Sequences for d3hbpa1:

Sequence; same for both SEQRES and ATOM records:

>d3hbpa1 d.176.1.0 (A:94-343) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
qdpfagdpprhpglrvnsqkpfnaeppaellaerfltpnelfftrnhlpvpavepssyrl
rvdgpgggtlslslaelrsrfpkhevtatlqsagnrrsemsrvrpvkglpwdigaistar
wggarlrdvllhagfpeelqgewhvcfegldadpggapygasipygralspaadvllaye
mngtelprdhgfpvrvvvpgvvgarsvkwlrrvavspdespshwqqndykgfspcvdwdt
vdyrtapaiq

Timeline for d3hbpa1:

• d3hbpa1 is new in SCOPe 2.03-stable
  
• d3hbpa1 appears in SCOPe 2.04
  
• d3hbpa1 appears in the current release, SCOPe 2.08