Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.176: Oxidoreductase molybdopterin-binding domain [56523] (1 superfamily) unusual fold; contains 3 layers of beta-sheet structure and a beta-grasp like motif |
Superfamily d.176.1: Oxidoreductase molybdopterin-binding domain [56524] (2 families) |
Family d.176.1.0: automated matches [227253] (1 protein) not a true family |
Protein automated matches [227034] (1 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [225869] (6 PDB entries) |
Domain d3hbpa1: 3hbp A:94-343 [210978] Other proteins in same PDB: d3hbpa2 automated match to d1ogpa2 complexed with mom, mte, so3; mutant |
PDB Entry: 3hbp (more details), 2.4 Å
SCOPe Domain Sequences for d3hbpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hbpa1 d.176.1.0 (A:94-343) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} qdpfagdpprhpglrvnsqkpfnaeppaellaerfltpnelfftrnhlpvpavepssyrl rvdgpgggtlslslaelrsrfpkhevtatlqsagnrrsemsrvrpvkglpwdigaistar wggarlrdvllhagfpeelqgewhvcfegldadpggapygasipygralspaadvllaye mngtelprdhgfpvrvvvpgvvgarsvkwlrrvavspdespshwqqndykgfspcvdwdt vdyrtapaiq
Timeline for d3hbpa1: