Lineage for d1mlcd2 (1mlc D:119-218)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221480Species Fab D44.1 (mouse), kappa L chain [49021] (2 PDB entries)
  8. 221486Domain d1mlcd2: 1mlc D:119-218 [21097]
    Other proteins in same PDB: d1mlca1, d1mlcb1, d1mlcc1, d1mlcd1, d1mlce_, d1mlcf_

Details for d1mlcd2

PDB Entry: 1mlc (more details), 2.1 Å

PDB Description: monoclonal antibody fab d44.1 raised against chicken egg-white lysozyme complexed with lysozyme

SCOP Domain Sequences for d1mlcd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mlcd2 b.1.1.2 (D:119-218) Immunoglobulin (constant domains of L and H chains) {Fab D44.1 (mouse), kappa L chain}
ttppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
tlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d1mlcd2:

Click to download the PDB-style file with coordinates for d1mlcd2.
(The format of our PDB-style files is described here.)

Timeline for d1mlcd2: