SCOP 1.73: Domain d1mlcc2: 1mlc C:109-214

Lineage for d1mlcc2 (1mlc C:109-214)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)

8. Domain d1mlcc2: 1mlc C:109-214 [21096]
   Other proteins in same PDB: d1mlca1, d1mlcb1, d1mlcb2, d1mlcc1, d1mlcd1, d1mlcd2, d1mlce_, d1mlcf_
   part of Fab D44.1

Details for d1mlcc2

PDB Entry: 1mlc, 2.1 Å

PDB Description: monoclonal antibody fab d44.1 raised against chicken egg-white lysozyme complexed with lysozyme

PDB Compounds: (C:) igg1-kappa d44.1 fab (light chain)

SCOP Domain Sequences for d1mlcc2:

Sequence; same for both SEQRES and ATOM records:

>d1mlcc2 b.1.1.2 (C:109-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1mlcc2:

• d1mlcc2 first appeared (with stable ids) in SCOP 1.55
  
• d1mlcc2 appears in SCOP 1.71
  
• d1mlcc2 appears in SCOP 1.75
  
• d1mlcc2 appears in the current release, SCOPe 2.08