Lineage for d3hb2p1 (3hb2 P:18-258)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1660634Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1660635Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1660899Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (2 proteins)
    characteristic HEXXHXXGXXH motif and Met located near C-terminus
  6. 1660900Protein Metalloprotease [55509] (4 species)
    the rest of protein is all-beta sandwich containing a parallel beta-helix
  7. 1660901Species Erwinia chrysanthemi [TaxId:556] [82735] (9 PDB entries)
    Protease C
  8. 1660903Domain d3hb2p1: 3hb2 P:18-258 [210958]
    Other proteins in same PDB: d3hb2p2
    automated match to d1af0a2
    complexed with ca, cl, zn; mutant

Details for d3hb2p1

PDB Entry: 3hb2 (more details), 1.75 Å

PDB Description: prtc methionine mutants: m226i
PDB Compounds: (P:) secreted protease C

SCOPe Domain Sequences for d3hb2p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hb2p1 d.92.1.6 (P:18-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]}
antssaynsvydflryhdrgdgltvngktsysidqaaaqitrenvswngtnvfgksanlt
fkflqsvssipsgdtgfvkfnaeqieqaklslqswsdvanltftevtgnksanitfgnyt
rdasgnldygtqayayypgnyqgagsswynynqsnirnpgseeygrqtfthaighalgla
hpgeynagegdpsyndavyaedsyqfsiisywgenetgadynghyggapmiddiaaiqrl
y

SCOPe Domain Coordinates for d3hb2p1:

Click to download the PDB-style file with coordinates for d3hb2p1.
(The format of our PDB-style files is described here.)

Timeline for d3hb2p1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hb2p2