![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) ![]() |
![]() | Family c.66.1.18: Mycolic acid cyclopropane synthase [69560] (7 proteins) |
![]() | Protein Methoxy mycolic acid synthase 4, Mma4 [142591] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [142592] (5 PDB entries) Uniprot Q79FX8 22-301 |
![]() | Domain d3ha5a_: 3ha5 A: [210947] automated match to d2fk7a1 complexed with sfg |
PDB Entry: 3ha5 (more details), 2.3 Å
SCOPe Domain Sequences for d3ha5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ha5a_ c.66.1.18 (A:) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} iqahydvsddffalfqdptrtyscayfeppeltleeaqyakvdlnldkldlkpgmtlldi gcgwgttmrraverfdvnvigltlsknqharceqvlasidtnrsrqvllqgwedfaepvd rivsieafehfghenyddffkrcfnimpadgrmtvqssvsyhpyemaargkklsfetarf ikfivteifpggrlpstemmvehgekagftvpeplslrphyiktlriwgdtlqsnkdkai evtseevynrymkylrgcehyftdemldcslvtylkpgaaa
Timeline for d3ha5a_: