Lineage for d1mlca2 (1mlc A:109-214)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104179Species Fab D44.1 (mouse), kappa L chain [49021] (2 PDB entries)
  8. 104182Domain d1mlca2: 1mlc A:109-214 [21094]
    Other proteins in same PDB: d1mlca1, d1mlcb1, d1mlcc1, d1mlcd1, d1mlce_, d1mlcf_

Details for d1mlca2

PDB Entry: 1mlc (more details), 2.1 Å

PDB Description: monoclonal antibody fab d44.1 raised against chicken egg-white lysozyme complexed with lysozyme

SCOP Domain Sequences for d1mlca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mlca2 b.1.1.2 (A:109-214) Immunoglobulin (constant domains of L and H chains) {Fab D44.1 (mouse), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1mlca2:

Click to download the PDB-style file with coordinates for d1mlca2.
(The format of our PDB-style files is described here.)

Timeline for d1mlca2: