Lineage for d1mlbb2 (1mlb B:119-218)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53744Species Fab D44.1 (mouse), kappa L chain [49021] (2 PDB entries)
  8. 53746Domain d1mlbb2: 1mlb B:119-218 [21093]
    Other proteins in same PDB: d1mlba1, d1mlbb1

Details for d1mlbb2

PDB Entry: 1mlb (more details), 2.1 Å

PDB Description: monoclonal antibody fab d44.1 raised against chicken egg-white lysozyme

SCOP Domain Sequences for d1mlbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mlbb2 b.1.1.2 (B:119-218) Immunoglobulin (constant domains of L and H chains) {Fab D44.1 (mouse), kappa L chain}
ttppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
tlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d1mlbb2:

Click to download the PDB-style file with coordinates for d1mlbb2.
(The format of our PDB-style files is described here.)

Timeline for d1mlbb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mlbb1