SCOP 1.59: Domain d1ibgh2: 1ibg H:114-223

Lineage for d1ibgh2 (1ibg H:114-223)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)

7. Species Fab 40-50 (mouse), kappa L chain [49020] (1 PDB entry)

8. Domain d1ibgh2: 1ibg H:114-223 [21091]
   Other proteins in same PDB: d1ibgh1, d1ibgl1

Details for d1ibgh2

PDB Entry: 1ibg, 2.7 Å

PDB Description: structure and specificity of the anti-digoxin antibody 40-50

SCOP Domain Sequences for d1ibgh2:

Sequence; same for both SEQRES and ATOM records:

>d1ibgh2 b.1.1.2 (H:114-223) Immunoglobulin (constant domains of L and H chains) {Fab 40-50 (mouse), kappa L chain}
akttppsvyplapgcgdttgssvtsgclvkgyfpepvtvtwnsgslsssvhtfpallqsg
lytmsssvtvpsstwpsqtvtcsvahpassttvdkkl

Timeline for d1ibgh2:

• d1ibgh2 first appeared (with stable ids) in SCOP 1.55
  
• d1ibgh2 appears in SCOP 1.57
  
• d1ibgh2 appears in SCOP 1.61
  
• d1ibgh2 appears in the current release, SCOPe 2.08