SCOPe 2.08: Domain d3h83b1: 3h83 B:1-179

Lineage for d3h83b1 (3h83 B:1-179)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (38 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:261594] [189450] (7 PDB entries)

8. Domain d3h83b1: 3h83 B:1-179 [210904]
   Other proteins in same PDB: d3h83a2, d3h83b2, d3h83c2, d3h83d2
   automated match to d1r3ub_
   complexed with po4

Details for d3h83b1

PDB Entry: 3h83, 2.06 Å

PDB Description: 2.06 angstrom resolution structure of a hypoxanthine-guanine phosphoribosyltransferase (hpt-1) from bacillus anthracis str. 'ames ancestor'

PDB Compounds: (B:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d3h83b1:

Sequence; same for both SEQRES and ATOM records:

>d3h83b1 c.61.1.0 (B:1-179) automated matches {Bacillus anthracis [TaxId: 261594]}
mmnqdiekvliseeqiqekvlelgaiiaedykntvplaigvlkgampfmadllkrtdtyl
emdfmavssyghstvstgevkilkdldtsvegrdilivediidsgltlsylvdlfkyrka
ksvkivtlldkptgrkvdlkadyvgftvphefvvgygldykeqyrnlpyvgvlkpsvys

Timeline for d3h83b1:

• d3h83b1 first appeared in SCOPe 2.03, called d3h83b_
  
• d3h83b1 appears in SCOPe 2.07