SCOPe 2.05: Domain d3h56a1: 3h56 A:4-161

Lineage for d3h56a1 (3h56 A:4-161)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (21 species)
   not a true protein

7. Species Alcaligenes faecalis [TaxId:511] [226762] (9 PDB entries)

8. Domain d3h56a1: 3h56 A:4-161 [210891]
   automated match to d1mzya1
   complexed with cu

Details for d3h56a1

PDB Entry: 3h56, 1.5 Å

PDB Description: met150leu/phe312cys variant of nitrite reductase from alcaligenes faecalis

PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d3h56a1:

Sequence; same for both SEQRES and ATOM records:

>d3h56a1 b.6.1.0 (A:4-161) automated matches {Alcaligenes faecalis [TaxId: 511]}
ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
fkatkpgvfvyhcappgmvpwhvvsglngaimvlpreg

Timeline for d3h56a1:

• d3h56a1 first appeared in SCOPe 2.03
  
• d3h56a1 appears in SCOPe 2.04
  
• d3h56a1 appears in SCOPe 2.06
  
• d3h56a1 appears in the current release, SCOPe 2.08