Class b: All beta proteins [48724] (180 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (41 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225771] (22 PDB entries) |
Domain d3h55b2: 3h55 B:310-404 [210890] Other proteins in same PDB: d3h55a1, d3h55b1 automated match to d1ktba1 complexed with cit, gla, nag |
PDB Entry: 3h55 (more details), 1.91 Å
SCOPe Domain Sequences for d3h55b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h55b2 b.71.1.0 (B:310-404) automated matches {Human (Homo sapiens) [TaxId: 9606]} lgiqgrrihkekslievymrplsnkasalvffscrtdmpyryhsslgqlnftgsviyeaq dvysgdiisglrdetnftviinpsgvvmwylypik
Timeline for d3h55b2: