Lineage for d1igch2 (1igc H:120-222)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104320Species Fab MoPC21 (mouse), kappa L chain [49019] (1 PDB entry)
  8. 104321Domain d1igch2: 1igc H:120-222 [21089]
    Other proteins in same PDB: d1igca_, d1igch1, d1igcl1

Details for d1igch2

PDB Entry: 1igc (more details), 2.6 Å

PDB Description: igg1 fab fragment (mopc21) complex with domain iii of protein g from streptococcus

SCOP Domain Sequences for d1igch2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igch2 b.1.1.2 (H:120-222) Immunoglobulin (constant domains of L and H chains) {Fab MoPC21 (mouse), kappa L chain}
sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d1igch2:

Click to download the PDB-style file with coordinates for d1igch2.
(The format of our PDB-style files is described here.)

Timeline for d1igch2: