Lineage for d3h4hc1 (3h4h C:5-161)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772230Species Alcaligenes faecalis [TaxId:511] [226762] (16 PDB entries)
  8. 2772255Domain d3h4hc1: 3h4h C:5-161 [210876]
    automated match to d1mzya1
    complexed with cu

Details for d3h4hc1

PDB Entry: 3h4h (more details), 1.6 Å

PDB Description: met94thr/phe312cys variant of nitrite reductase from alcaligenes faecalis
PDB Compounds: (C:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d3h4hc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h4hc1 b.6.1.0 (C:5-161) automated matches {Alcaligenes faecalis [TaxId: 511]}
taaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamaf
ngtvpgplmvvhqddyleltlinpetntlthnidfhaatgalgggglteinpgektilrf
katkpgvfvyhcappgmvpwhvvsgmngaimvlpreg

SCOPe Domain Coordinates for d3h4hc1:

Click to download the PDB-style file with coordinates for d3h4hc1.
(The format of our PDB-style files is described here.)

Timeline for d3h4hc1: