SCOP 1.55: Domain d1ikfl2: 1ikf L:108-214

Lineage for d1ikfl2 (1ikf L:108-214)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab, anti-cyclosporin A, (mouse), kappa L chain [49018] (1 PDB entry)

8. Domain d1ikfl2: 1ikf L:108-214 [21086]
   Other proteins in same PDB: d1ikfh1, d1ikfl1

Details for d1ikfl2

PDB Entry: 1ikf, 2.5 Å

PDB Description: a conformation of cyclosporin a in aqueous environment revealed by the x-ray structure of a cyclosporin-fab complex

SCOP Domain Sequences for d1ikfl2:

Sequence; same for both SEQRES and ATOM records:

>d1ikfl2 b.1.1.2 (L:108-214) Immunoglobulin (constant domains of L and H chains) {Fab, anti-cyclosporin A, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnraac

Timeline for d1ikfl2:

• d1ikfl2 appears in SCOP 1.57
  
• d1ikfl2 appears in the current release, SCOPe 2.08