Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
Species Fab, anti-cyclosporin A, (mouse), kappa L chain [49018] (1 PDB entry) |
Domain d1ikfl2: 1ikf L:108-214 [21086] Other proteins in same PDB: d1ikfh1, d1ikfl1 |
PDB Entry: 1ikf (more details), 2.5 Å
SCOP Domain Sequences for d1ikfl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ikfl2 b.1.1.2 (L:108-214) Immunoglobulin (constant domains of L and H chains) {Fab, anti-cyclosporin A, (mouse), kappa L chain} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnraac
Timeline for d1ikfl2: