Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d3h3pi1: 3h3p I:1-126 [210847] Other proteins in same PDB: d3h3ph2, d3h3pi2 automated match to d3ebaa_ complexed with ca |
PDB Entry: 3h3p (more details), 2.7 Å
SCOPe Domain Sequences for d3h3pi1:
Sequence, based on SEQRES records: (download)
>d3h3pi1 b.1.1.0 (I:1-126) automated matches {Human (Homo sapiens) [TaxId: 9606]} qvqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitny aprfqgrititadrststaylelnslrpedtavyycaregttgagwlgkpigafahwgqg tlvtvs
>d3h3pi1 b.1.1.0 (I:1-126) automated matches {Human (Homo sapiens) [TaxId: 9606]} qvqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitny aprfqgrititadrststaylelnslrpedtavyycaregttgwlgkpigafahwgqgtl vtvs
Timeline for d3h3pi1:
View in 3D Domains from other chains: (mouse over for more information) d3h3ph1, d3h3ph2, d3h3pl_, d3h3pm_ |