Lineage for d3h3pi1 (3h3p I:1-126)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2367580Domain d3h3pi1: 3h3p I:1-126 [210847]
    Other proteins in same PDB: d3h3ph2, d3h3pi2
    automated match to d3ebaa_
    complexed with ca

Details for d3h3pi1

PDB Entry: 3h3p (more details), 2.7 Å

PDB Description: Crystal structure of HIV epitope-scaffold 4E10 Fv complex
PDB Compounds: (I:) Fv 4E10 heavy chain

SCOPe Domain Sequences for d3h3pi1:

Sequence, based on SEQRES records: (download)

>d3h3pi1 b.1.1.0 (I:1-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitny
aprfqgrititadrststaylelnslrpedtavyycaregttgagwlgkpigafahwgqg
tlvtvs

Sequence, based on observed residues (ATOM records): (download)

>d3h3pi1 b.1.1.0 (I:1-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitny
aprfqgrititadrststaylelnslrpedtavyycaregttgwlgkpigafahwgqgtl
vtvs

SCOPe Domain Coordinates for d3h3pi1:

Click to download the PDB-style file with coordinates for d3h3pi1.
(The format of our PDB-style files is described here.)

Timeline for d3h3pi1: