Lineage for d1fptl2 (1fpt L:109-213)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8844Species Fab C3, neutralizing type 1 poliovirus, (mouse), kappa L chain [49017] (1 PDB entry)
  8. 8846Domain d1fptl2: 1fpt L:109-213 [21084]
    Other proteins in same PDB: d1fpth1, d1fptl1

Details for d1fptl2

PDB Entry: 1fpt (more details), 3 Å

PDB Description: three-dimensional structure of the complex between the fab fragment of an neutralizing antibody for type 1 poliovirus and its viral epitope

SCOP Domain Sequences for d1fptl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fptl2 b.1.1.2 (L:109-213) Immunoglobulin (constant domains of L and H chains) {Fab C3, neutralizing type 1 poliovirus, (mouse), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgsevqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOP Domain Coordinates for d1fptl2:

Click to download the PDB-style file with coordinates for d1fptl2.
(The format of our PDB-style files is described here.)

Timeline for d1fptl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fptl1