Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
Protein automated matches [226850] (47 species) not a true protein |
Species Staphylococcus aureus [TaxId:93062] [225656] (3 PDB entries) |
Domain d3h3jb2: 3h3j B:149-317 [210833] Other proteins in same PDB: d3h3ja1, d3h3jb1 automated match to d2ldba2 complexed with gol, nad, pyr; mutant |
PDB Entry: 3h3j (more details), 1.8 Å
SCOPe Domain Sequences for d3h3jb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h3jb2 d.162.1.0 (B:149-317) automated matches {Staphylococcus aureus [TaxId: 93062]} tildsarfrlllseafdvaprsvdaqiigehgdtelpvwshaniagqplktlleqrpegk aqieqifvqtrdaaydiiqakgatyygvamglariteaifrnedavltvsallegeyeee dvyigvpavinrngirnvveiplndeeqskfahsaktlkdimaeaeelk
Timeline for d3h3jb2: