Lineage for d3h3ja1 (3h3j A:4-148)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848603Species Staphylococcus aureus [TaxId:93062] [225655] (3 PDB entries)
  8. 2848608Domain d3h3ja1: 3h3j A:4-148 [210830]
    Other proteins in same PDB: d3h3ja2, d3h3jb2
    automated match to d1ldna1
    complexed with gol, nad, pyr; mutant

Details for d3h3ja1

PDB Entry: 3h3j (more details), 1.8 Å

PDB Description: crystal structure of lactate dehydrogenase mutant (a85r) from staphylococcus aureus complexed with nad and pyruvate
PDB Compounds: (A:) L-lactate dehydrogenase 1

SCOPe Domain Sequences for d3h3ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h3ja1 c.2.1.0 (A:4-148) automated matches {Staphylococcus aureus [TaxId: 93062]}
fkgnkvvligngavgssyafslvnqsivdelviidldtekvrgdvmdlkhatpyspttvr
vkageysdchdadlvvicagarqkpgetrldlvsknlkifksivgevmaskfdgiflvat
npvdilayatwkfsglpkervigsg

SCOPe Domain Coordinates for d3h3ja1:

Click to download the PDB-style file with coordinates for d3h3ja1.
(The format of our PDB-style files is described here.)

Timeline for d3h3ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3h3ja2