Lineage for d1rmfh2 (1rmf H:120-216)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1515183Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 1515499Species Mouse (Mus musculus) [TaxId:10090] [88576] (415 PDB entries)
    Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form
  8. 1515828Domain d1rmfh2: 1rmf H:120-216 [21083]
    Other proteins in same PDB: d1rmfh1, d1rmfl1, d1rmfl2
    part of Fab R6.5

Details for d1rmfh2

PDB Entry: 1rmf (more details), 2.8 Å

PDB Description: structures of a monoclonal anti-icam-1 antibody r6.5 fragment at 2.8 angstroms resolution
PDB Compounds: (H:) igg2a-kappa r6.5 fab (heavy chain)

SCOPe Domain Sequences for d1rmfh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rmfh2 b.1.1.2 (H:120-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttapsvtplapvcgdttgssvtlgvlvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkki

SCOPe Domain Coordinates for d1rmfh2:

Click to download the PDB-style file with coordinates for d1rmfh2.
(The format of our PDB-style files is described here.)

Timeline for d1rmfh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rmfh1