SCOPe 2.04: Domain d3h3fe1: 3h3f E:1-159

Lineage for d3h3fe1 (3h3f E:1-159)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein automated matches [226881] (6 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225718] (5 PDB entries)

8. Domain d3h3fe1: 3h3f E:1-159 [210822]
   Other proteins in same PDB: d3h3fa2, d3h3fb2, d3h3fc2, d3h3fd2, d3h3fe2, d3h3ff2, d3h3fg2, d3h3fh2
   automated match to d9ldta1
   complexed with act, nai, oxm

Details for d3h3fe1

PDB Entry: 3h3f, 2.38 Å

PDB Description: Rabbit muscle L-lactate dehydrogenase in complex with NADH and oxamate

PDB Compounds: (E:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d3h3fe1:

Sequence; same for both SEQRES and ATOM records:

>d3h3fe1 c.2.1.5 (E:1-159) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkysphckllvvsnpvdiltyvawkisgfpknrvig

Timeline for d3h3fe1:

• d3h3fe1 first appeared in SCOPe 2.03
  
• d3h3fe1 appears in SCOPe 2.05
  
• d3h3fe1 appears in the current release, SCOPe 2.08