SCOP 1.71: Domain d1fbip2: 1fbi P:108-214

Lineage for d1fbip2 (1fbi P:108-214)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (284 PDB entries)

8. Domain d1fbip2: 1fbi P:108-214 [21080]
   Other proteins in same PDB: d1fbih1, d1fbih2, d1fbil1, d1fbip1, d1fbiq1, d1fbiq2, d1fbix_, d1fbiy_
   part of Fab F9.13.7

Details for d1fbip2

PDB Entry: 1fbi, 3 Å

PDB Description: crystal structure of a cross-reaction complex between fab f9.13.7 and guinea-fowl lysozyme

SCOP Domain Sequences for d1fbip2:

Sequence; same for both SEQRES and ATOM records:

>d1fbip2 b.1.1.2 (P:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1fbip2:

• d1fbip2 first appeared (with stable ids) in SCOP 1.55
  
• d1fbip2 appears in SCOP 1.69
  
• d1fbip2 appears in SCOP 1.73
  
• d1fbip2 appears in the current release, SCOPe 2.08