Lineage for d1fbih2 (1fbi H:122-221)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365019Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 365143Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries)
  8. 365424Domain d1fbih2: 1fbi H:122-221 [21079]
    Other proteins in same PDB: d1fbih1, d1fbil1, d1fbil2, d1fbip1, d1fbip2, d1fbiq1, d1fbix_, d1fbiy_

Details for d1fbih2

PDB Entry: 1fbi (more details), 3 Å

PDB Description: crystal structure of a cross-reaction complex between fab f9.13.7 and guinea-fowl lysozyme

SCOP Domain Sequences for d1fbih2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbih2 b.1.1.2 (H:122-221) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivp

SCOP Domain Coordinates for d1fbih2:

Click to download the PDB-style file with coordinates for d1fbih2.
(The format of our PDB-style files is described here.)

Timeline for d1fbih2: