SCOP 1.63: Domain d1fbih2: 1fbi H:122-221

Lineage for d1fbih2 (1fbi H:122-221)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fab F9.13.7 (mouse), kappa L chain [49015] (1 PDB entry)

8. Domain d1fbih2: 1fbi H:122-221 [21079]
   Other proteins in same PDB: d1fbih1, d1fbil1, d1fbip1, d1fbiq1, d1fbix_, d1fbiy_

Details for d1fbih2

PDB Entry: 1fbi, 3 Å

PDB Description: crystal structure of a cross-reaction complex between fab f9.13.7 and guinea-fowl lysozyme

SCOP Domain Sequences for d1fbih2:

Sequence; same for both SEQRES and ATOM records:

>d1fbih2 b.1.1.2 (H:122-221) Immunoglobulin (constant domains of L and H chains) {Fab F9.13.7 (mouse), kappa L chain}
sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivp

Timeline for d1fbih2:

• d1fbih2 first appeared (with stable ids) in SCOP 1.55
  
• d1fbih2 appears in SCOP 1.61
  
• d1fbih2 appears in SCOP 1.65
  
• d1fbih2 appears in the current release, SCOPe 2.08