Lineage for d1fbih2 (1fbi H:122-221)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104214Species Fab F9.13.7 (mouse), kappa L chain [49015] (1 PDB entry)
  8. 104215Domain d1fbih2: 1fbi H:122-221 [21079]
    Other proteins in same PDB: d1fbih1, d1fbil1, d1fbip1, d1fbiq1, d1fbix_, d1fbiy_

Details for d1fbih2

PDB Entry: 1fbi (more details), 3 Å

PDB Description: crystal structure of a cross-reaction complex between fab f9.13.7 and guinea-fowl lysozyme

SCOP Domain Sequences for d1fbih2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbih2 b.1.1.2 (H:122-221) Immunoglobulin (constant domains of L and H chains) {Fab F9.13.7 (mouse), kappa L chain}
sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivp

SCOP Domain Coordinates for d1fbih2:

Click to download the PDB-style file with coordinates for d1fbih2.
(The format of our PDB-style files is described here.)

Timeline for d1fbih2: