Lineage for d1mrch2 (1mrc H:116-227)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365019Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 365143Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries)
  8. 365296Domain d1mrch2: 1mrc H:116-227 [21077]
    Other proteins in same PDB: d1mrch1, d1mrcl1, d1mrcl2
    part of Fab Jel 103
    complexed with imd, so4, zn

Details for d1mrch2

PDB Entry: 1mrc (more details), 2.4 Å

PDB Description: preparation, characterization and crystallization of an antibody fab fragment that recognizes rna. crystal structures of native fab and three fab-mononucleotide complexes

SCOP Domain Sequences for d1mrch2:

Sequence, based on SEQRES records: (download)

>d1mrch2 b.1.1.2 (H:116-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
ttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsgly
tmsssvtvpsstwpsqtvtcsvahpassttvdkklep

Sequence, based on observed residues (ATOM records): (download)

>d1mrch2 b.1.1.2 (H:116-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
ttppsvyplapttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsglytmss
svtvpsstwpsqtvtcsvahpassttvdkklep

SCOP Domain Coordinates for d1mrch2:

Click to download the PDB-style file with coordinates for d1mrch2.
(The format of our PDB-style files is described here.)

Timeline for d1mrch2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mrch1