Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (35 species) not a true protein |
Species Chlorobaculum tepidum [TaxId:1097] [225664] (1 PDB entry) |
Domain d3h08a_: 3h08 A: [210752] automated match to d2zqbb_ complexed with mg |
PDB Entry: 3h08 (more details), 1.6 Å
SCOPe Domain Sequences for d3h08a_:
Sequence, based on SEQRES records: (download)
>d3h08a_ c.55.3.0 (A:) automated matches {Chlorobaculum tepidum [TaxId: 1097]} ektitiytdgaasgnpgkggwgallmygssrkeisgydpattnnrmelmaaikglealke parvqlysdsaylvnamnegwlkrwvkngwktaakkpvenidlwqeilklttlhrvtfhk vkghsdnpynsradelarlaiken
>d3h08a_ c.55.3.0 (A:) automated matches {Chlorobaculum tepidum [TaxId: 1097]} ektitiytdgaasgnpgkggwgallmygssrkeisgydpattnnrmelmaaikglealke parvqlysdsaylvnamnegwlkrwvkngwkkpvenidlwqeilklttlhrvtfhkvkgs dnpynsradelarlaiken
Timeline for d3h08a_: