Lineage for d1mrfh2 (1mrf H:116-227)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221569Species Fab Jel 103 (mouse), kappa L chain [49014] (4 PDB entries)
  8. 221574Domain d1mrfh2: 1mrf H:116-227 [21075]
    Other proteins in same PDB: d1mrfh1, d1mrfl1
    complexed with imd, oip, zn

Details for d1mrfh2

PDB Entry: 1mrf (more details), 2.4 Å

PDB Description: preparation, characterization and crystallization of an antibody fab fragment that recognizes rna. crystal structures of native fab and three fab-mononucleotide complexes

SCOP Domain Sequences for d1mrfh2:

Sequence, based on SEQRES records: (download)

>d1mrfh2 b.1.1.2 (H:116-227) Immunoglobulin (constant domains of L and H chains) {Fab Jel 103 (mouse), kappa L chain}
ttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsgly
tmsssvtvpsstwpsqtvtcsvahpassttvdkklep

Sequence, based on observed residues (ATOM records): (download)

>d1mrfh2 b.1.1.2 (H:116-227) Immunoglobulin (constant domains of L and H chains) {Fab Jel 103 (mouse), kappa L chain}
ttppsvyplapgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsglytmsssv
tvpsstwpsqtvtcsvahpassttvdkklep

SCOP Domain Coordinates for d1mrfh2:

Click to download the PDB-style file with coordinates for d1mrfh2.
(The format of our PDB-style files is described here.)

Timeline for d1mrfh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mrfh1