| Class b: All beta proteins [48724] (165 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries) |
| Domain d1mrfl2: 1mrf L:109-211 [21074] Other proteins in same PDB: d1mrfh1, d1mrfh2, d1mrfl1 part of Fab Jel 103 complexed with imd, oip, zn |
PDB Entry: 1mrf (more details), 2.4 Å
SCOP Domain Sequences for d1mrfl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mrfl2 b.1.1.2 (L:109-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgkerqngvlnswtdqns
kdstysmsstltltkdeyerhnsytceathktstspivksfnr
Timeline for d1mrfl2: