Lineage for d1mrfl2 (1mrf L:109-211)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656263Domain d1mrfl2: 1mrf L:109-211 [21074]
    Other proteins in same PDB: d1mrfh1, d1mrfh2, d1mrfl1
    part of Fab Jel 103
    complexed with imd, oip, zn

Details for d1mrfl2

PDB Entry: 1mrf (more details), 2.4 Å

PDB Description: preparation, characterization and crystallization of an antibody fab fragment that recognizes rna. crystal structures of native fab and three fab-mononucleotide complexes
PDB Compounds: (L:) igg2b-kappa jel103 fab (light chain)

SCOP Domain Sequences for d1mrfl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mrfl2 b.1.1.2 (L:109-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgkerqngvlnswtdqns
kdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d1mrfl2:

Click to download the PDB-style file with coordinates for d1mrfl2.
(The format of our PDB-style files is described here.)

Timeline for d1mrfl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mrfl1