Lineage for d1mrdh2 (1mrd H:116-227)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549023Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 549177Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries)
  8. 549319Domain d1mrdh2: 1mrd H:116-227 [21071]
    Other proteins in same PDB: d1mrdh1, d1mrdl1, d1mrdl2
    part of Fab Jel 103
    complexed with idp, imd, zn

Details for d1mrdh2

PDB Entry: 1mrd (more details), 2.3 Å

PDB Description: preparation, characterization and crystallization of an antibody fab fragment that recognizes rna. crystal structures of native fab and three fab-mononucleotide complexes

SCOP Domain Sequences for d1mrdh2:

Sequence, based on SEQRES records: (download)

>d1mrdh2 b.1.1.2 (H:116-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
ttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsgly
tmsssvtvpsstwpsqtvtcsvahpassttvdkklep

Sequence, based on observed residues (ATOM records): (download)

>d1mrdh2 b.1.1.2 (H:116-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
ttppsvyplapgttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsglytms
ssvtvpsstwpsqtvtcsvahpassttvdkklep

SCOP Domain Coordinates for d1mrdh2:

Click to download the PDB-style file with coordinates for d1mrdh2.
(The format of our PDB-style files is described here.)

Timeline for d1mrdh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mrdh1