Lineage for d1mrdl2 (1mrd L:109-211)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104268Species Fab Jel 103 (mouse), kappa L chain [49014] (4 PDB entries)
  8. 104270Domain d1mrdl2: 1mrd L:109-211 [21070]
    Other proteins in same PDB: d1mrdh1, d1mrdl1

Details for d1mrdl2

PDB Entry: 1mrd (more details), 2.3 Å

PDB Description: preparation, characterization and crystallization of an antibody fab fragment that recognizes rna. crystal structures of native fab and three fab-mononucleotide complexes

SCOP Domain Sequences for d1mrdl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mrdl2 b.1.1.2 (L:109-211) Immunoglobulin (constant domains of L and H chains) {Fab Jel 103 (mouse), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgkerqngvlnswtdqns
kdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d1mrdl2:

Click to download the PDB-style file with coordinates for d1mrdl2.
(The format of our PDB-style files is described here.)

Timeline for d1mrdl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mrdl1