SCOP 1.57: Domain d1mrdl2: 1mrd L:109-211

Lineage for d1mrdl2 (1mrd L:109-211)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)

7. Species Fab Jel 103 (mouse), kappa L chain [49014] (4 PDB entries)

8. Domain d1mrdl2: 1mrd L:109-211 [21070]
   Other proteins in same PDB: d1mrdh1, d1mrdl1

Details for d1mrdl2

PDB Entry: 1mrd, 2.3 Å

PDB Description: preparation, characterization and crystallization of an antibody fab fragment that recognizes rna. crystal structures of native fab and three fab-mononucleotide complexes

SCOP Domain Sequences for d1mrdl2:

Sequence; same for both SEQRES and ATOM records:

>d1mrdl2 b.1.1.2 (L:109-211) Immunoglobulin (constant domains of L and H chains) {Fab Jel 103 (mouse), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgkerqngvlnswtdqns
kdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d1mrdl2:

• d1mrdl2 first appeared (with stable ids) in SCOP 1.55
  
• d1mrdl2 appears in SCOP 1.59
  
• d1mrdl2 appears in the current release, SCOPe 2.08