| Class b: All beta proteins [48724] (165 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries) |
| Domain d1eapb2: 1eap B:125-221 [21069] Other proteins in same PDB: d1eapa1, d1eapa2, d1eapb1 part of Fab 17E8 complexed with hep |
PDB Entry: 1eap (more details), 2.5 Å
SCOP Domain Sequences for d1eapb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eapb2 b.1.1.2 (B:125-221) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgglsssvhtfpallqsg
lytmsssvtvpgggwpsatvtcsvahpassttvdkkl
Timeline for d1eapb2: