SCOP 1.57: Domain d1eapb2: 1eap B:125-221

Lineage for d1eapb2 (1eap B:125-221)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)

7. Species Fab 17E8 (mouse), kappa L chain [49013] (1 PDB entry)

8. Domain d1eapb2: 1eap B:125-221 [21069]
   Other proteins in same PDB: d1eapa1, d1eapb1

Details for d1eapb2

PDB Entry: 1eap, 2.5 Å

PDB Description: crystal structure of a catalytic antibody with a serine protease active site

SCOP Domain Sequences for d1eapb2:

Sequence; same for both SEQRES and ATOM records:

>d1eapb2 b.1.1.2 (B:125-221) Immunoglobulin (constant domains of L and H chains) {Fab 17E8 (mouse), kappa L chain}
akttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgglsssvhtfpallqsg
lytmsssvtvpgggwpsatvtcsvahpassttvdkkl

Timeline for d1eapb2:

• d1eapb2 first appeared (with stable ids) in SCOP 1.55
  
• d1eapb2 appears in SCOP 1.59
  
• d1eapb2 appears in the current release, SCOPe 2.08