Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (181 species) not a true protein |
Species Brucella melitensis [TaxId:359391] [189369] (3 PDB entries) |
Domain d3gvie1: 3gvi E:2-144 [210683] Other proteins in same PDB: d3gvia2, d3gvib2, d3gvic2, d3gvid2, d3gvie2, d3gvif2 automated match to d1guza1 complexed with adp |
PDB Entry: 3gvi (more details), 2.25 Å
SCOPe Domain Sequences for d3gvie1:
Sequence, based on SEQRES records: (download)
>d3gvie1 c.2.1.0 (E:2-144) automated matches {Brucella melitensis [TaxId: 359391]} arnkialigsgmiggtlahlaglkelgdvvlfdiaegtpqgkgldiaesspvdgfdakft gandyaaiegadvvivtagvprkpgmsrddllginlkvmeqvgagikkyapeafvicitn pldamvwalqkfsglpahkvvgm
>d3gvie1 c.2.1.0 (E:2-144) automated matches {Brucella melitensis [TaxId: 359391]} arnkialigsgmiggtlahlaglkelgdvvlfdiaegtpqgkgldiaesspvdgfdakft gandyaaiegadvvivtagvprkddllginlkvmeqvgagikkyapeafvicitnpldam vwalqkfsglpahkvvgm
Timeline for d3gvie1: