Lineage for d3gvib2 (3gvi B:145-320)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2233134Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2233135Protein automated matches [226850] (29 species)
    not a true protein
  7. 2233170Species Brucella melitensis [TaxId:359391] [225649] (2 PDB entries)
  8. 2233172Domain d3gvib2: 3gvi B:145-320 [210678]
    Other proteins in same PDB: d3gvia1, d3gvib1, d3gvic1, d3gvid1, d3gvie1, d3gvif1
    automated match to d1guza2
    complexed with adp

Details for d3gvib2

PDB Entry: 3gvi (more details), 2.25 Å

PDB Description: Crystal structure of Lactate/malate dehydrogenase from Brucella melitensis in complex with ADP
PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d3gvib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gvib2 d.162.1.0 (B:145-320) automated matches {Brucella melitensis [TaxId: 359391]}
agvldsarfryflseefnvsvedvtvfvlgghgdsmvplarystvagiplpdlvkmgwts
qdkldkiiqrtrdggaeivgllktgsafyapaasaiqmaesylkdkkrvlpvaaqlsgqy
gvkdmyvgvptvigangveriieidldkdekaqfdksvasvaglceacigiapslk

SCOPe Domain Coordinates for d3gvib2:

Click to download the PDB-style file with coordinates for d3gvib2.
(The format of our PDB-style files is described here.)

Timeline for d3gvib2: