Lineage for d3gvhc2 (3gvh C:145-319)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2999522Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2999523Protein automated matches [226850] (47 species)
    not a true protein
  7. 2999582Species Brucella melitensis [TaxId:359391] [225649] (2 PDB entries)
  8. 2999591Domain d3gvhc2: 3gvh C:145-319 [210672]
    Other proteins in same PDB: d3gvha1, d3gvhb1, d3gvhc1, d3gvhd1
    automated match to d1guza2
    complexed with nad

Details for d3gvhc2

PDB Entry: 3gvh (more details), 2.3 Å

PDB Description: Crystal structure of Lactate/malate dehydrogenase from Brucella melitensis
PDB Compounds: (C:) malate dehydrogenase

SCOPe Domain Sequences for d3gvhc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gvhc2 d.162.1.0 (C:145-319) automated matches {Brucella melitensis [TaxId: 359391]}
agvldsarfryflseefnvsvedvtvfvlgghgdsmvplarystvagiplpdlvkmgwts
qdkldkiiqrtrdggaeivgllktgsafyapaasaiqmaesylkdkkrvlpvaaqlsgqy
gvkdmyvgvptvigangveriieidldkdekaqfdksvasvaglceacigiapsl

SCOPe Domain Coordinates for d3gvhc2:

Click to download the PDB-style file with coordinates for d3gvhc2.
(The format of our PDB-style files is described here.)

Timeline for d3gvhc2: