Lineage for d3gvhb2 (3gvh B:145-319)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938734Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1938735Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1939262Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 1939263Protein automated matches [226850] (26 species)
    not a true protein
  7. 1939298Species Brucella melitensis [TaxId:359391] [225649] (2 PDB entries)
  8. 1939306Domain d3gvhb2: 3gvh B:145-319 [210670]
    Other proteins in same PDB: d3gvha1, d3gvhb1, d3gvhc1, d3gvhd1
    automated match to d1guza2
    complexed with nad

Details for d3gvhb2

PDB Entry: 3gvh (more details), 2.3 Å

PDB Description: Crystal structure of Lactate/malate dehydrogenase from Brucella melitensis
PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d3gvhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gvhb2 d.162.1.0 (B:145-319) automated matches {Brucella melitensis [TaxId: 359391]}
agvldsarfryflseefnvsvedvtvfvlgghgdsmvplarystvagiplpdlvkmgwts
qdkldkiiqrtrdggaeivgllktgsafyapaasaiqmaesylkdkkrvlpvaaqlsgqy
gvkdmyvgvptvigangveriieidldkdekaqfdksvasvaglceacigiapsl

SCOPe Domain Coordinates for d3gvhb2:

Click to download the PDB-style file with coordinates for d3gvhb2.
(The format of our PDB-style files is described here.)

Timeline for d3gvhb2: