Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
Protein automated matches [226850] (47 species) not a true protein |
Species Brucella melitensis [TaxId:359391] [225649] (2 PDB entries) |
Domain d3gvhb2: 3gvh B:145-319 [210670] Other proteins in same PDB: d3gvha1, d3gvhb1, d3gvhc1, d3gvhd1 automated match to d1guza2 complexed with nad |
PDB Entry: 3gvh (more details), 2.3 Å
SCOPe Domain Sequences for d3gvhb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gvhb2 d.162.1.0 (B:145-319) automated matches {Brucella melitensis [TaxId: 359391]} agvldsarfryflseefnvsvedvtvfvlgghgdsmvplarystvagiplpdlvkmgwts qdkldkiiqrtrdggaeivgllktgsafyapaasaiqmaesylkdkkrvlpvaaqlsgqy gvkdmyvgvptvigangveriieidldkdekaqfdksvasvaglceacigiapsl
Timeline for d3gvhb2: