Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
Species Fab CNJ206 (mouse), kappa L chain [49012] (2 PDB entries) |
Domain d1knof2: 1kno F:120-235 [21067] Other proteins in same PDB: d1knoa1, d1knob1, d1knoc1, d1knod1, d1knoe1, d1knof1 complexed with pnp, zn |
PDB Entry: 1kno (more details), 3.2 Å
SCOP Domain Sequences for d1knof2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1knof2 b.1.1.2 (F:120-235) Immunoglobulin (constant domains of L and H chains) {Fab CNJ206 (mouse), kappa L chain} akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg
Timeline for d1knof2: