Lineage for d3gvhb1 (3gvh B:2-144)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1580387Species Brucella melitensis [TaxId:359391] [189369] (3 PDB entries)
  8. 1580399Domain d3gvhb1: 3gvh B:2-144 [210669]
    Other proteins in same PDB: d3gvha2, d3gvhb2, d3gvhc2, d3gvhd2
    automated match to d1guza1
    complexed with nad

Details for d3gvhb1

PDB Entry: 3gvh (more details), 2.3 Å

PDB Description: Crystal structure of Lactate/malate dehydrogenase from Brucella melitensis
PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d3gvhb1:

Sequence, based on SEQRES records: (download)

>d3gvhb1 c.2.1.0 (B:2-144) automated matches {Brucella melitensis [TaxId: 359391]}
arnkialigsgmiggtlahlaglkelgdvvlfdiaegtpqgkgldiaesspvdgfdakft
gandyaaiegadvvivtagvprkpgmsrddllginlkvmeqvgagikkyapeafvicitn
pldamvwalqkfsglpahkvvgm

Sequence, based on observed residues (ATOM records): (download)

>d3gvhb1 c.2.1.0 (B:2-144) automated matches {Brucella melitensis [TaxId: 359391]}
arnkialigsgmiggtlahlaglkelgdvvlfdiaegtpqgkgldiaesspvdgfdakft
gandyaaiegadvvivtagvpsrddllginlkvmeqvgagikkyapeafvicitnpldam
vwalqkfsglpahkvvgm

SCOPe Domain Coordinates for d3gvhb1:

Click to download the PDB-style file with coordinates for d3gvhb1.
(The format of our PDB-style files is described here.)

Timeline for d3gvhb1: