SCOPe 2.08: Domain d3gusb1: 3gus B:2-76

Lineage for d3gusb1 (3gus B:2-76)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class pi GST [81358] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52864] (64 PDB entries)

8. Domain d3gusb1: 3gus B:2-76 [210662]
   Other proteins in same PDB: d3gusa2, d3gusb2
   automated match to d1aqwa2
   complexed with gsh, mes, n11, so4

Details for d3gusb1

PDB Entry: 3gus, 1.53 Å

PDB Description: Crystal strcture of human Pi class glutathione S-transferase GSTP1-1 in complex with 6-(7-Nitro-2,1,3-benzoxadiazol-4-ylthio)hexanol (NBDHEX)

PDB Compounds: (B:) Glutathione S-transferase P

SCOPe Domain Sequences for d3gusb1:

Sequence; same for both SEQRES and ATOM records:

>d3gusb1 c.47.1.5 (B:2-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtl

Timeline for d3gusb1:

• d3gusb1 first appeared in SCOPe 2.03
  
• d3gusb1 appears in SCOPe 2.07