SCOPe 2.06: Domain d1knoe2: 1kno E:109-214

Lineage for d1knoe2 (1kno E:109-214)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

Species Mouse (Mus musculus) [TaxId:10090] [88567] (358 PDB entries)
Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region

Domain d1knoe2: 1kno E:109-214 [21066]
Other proteins in same PDB: d1knoa1, d1knob1, d1knob2, d1knoc1, d1knod1, d1knod2, d1knoe1, d1knof1, d1knof2
part of Fab CNJ206
complexed with pnp, zn

Details for d1knoe2

PDB Entry: 1kno (more details), 3.2 Å

PDB Description: crystal structure of the complex of a catalytic antibody fab with a transition state analog: structural similarities in esterase-like abzymes

PDB Compounds: (E:) igg2a fab fragment cnj206

SCOPe Domain Sequences for d1knoe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knoe2 b.1.1.2 (E:109-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d1knoe2:

Click to download the PDB-style file with coordinates for d1knoe2.
(The format of our PDB-style files is described here.)

Timeline for d1knoe2: