SCOP 1.65: Domain d1knoe2: 1kno E:109-214

Lineage for d1knoe2 (1kno E:109-214)

Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries)
Domain d1knoe2: 1kno E:109-214 [21066]
Other proteins in same PDB: d1knoa1, d1knob1, d1knob2, d1knoc1, d1knod1, d1knod2, d1knoe1, d1knof1, d1knof2
part of Fab CNJ206
complexed with pnp, zn

Details for d1knoe2

PDB Entry: 1kno (more details), 3.2 Å

PDB Description: crystal structure of the complex of a catalytic antibody fab with a transition state analog: structural similarities in esterase-like abzymes

SCOP Domain Sequences for d1knoe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knoe2 b.1.1.2 (E:109-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1knoe2:

Click to download the PDB-style file with coordinates for d1knoe2.
(The format of our PDB-style files is described here.)

Timeline for d1knoe2: