SCOP 1.61: Domain d1knoe2: 1kno E:109-214

Lineage for d1knoe2 (1kno E:109-214)

Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (6 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
Species Fab CNJ206 (mouse), kappa L chain [49012] (2 PDB entries)
Domain d1knoe2: 1kno E:109-214 [21066]
Other proteins in same PDB: d1knoa1, d1knob1, d1knoc1, d1knod1, d1knoe1, d1knof1

Details for d1knoe2

PDB Entry: 1kno (more details), 3.2 Å

PDB Description: crystal structure of the complex of a catalytic antibody fab with a transition state analog: structural similarities in esterase-like abzymes

SCOP Domain Sequences for d1knoe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knoe2 b.1.1.2 (E:109-214) Immunoglobulin (constant domains of L and H chains) {Fab CNJ206 (mouse), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1knoe2:

Click to download the PDB-style file with coordinates for d1knoe2.
(The format of our PDB-style files is described here.)

Timeline for d1knoe2: