SCOPe 2.06: Domain d3grcc_: 3grc C:

Lineage for d3grcc_ (3grc C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (71 species)
   not a true protein

7. Species Polaromonas sp. [TaxId:296591] [225647] (1 PDB entry)

8. Domain d3grcc_: 3grc C: [210642]
   automated match to d1chna_

Details for d3grcc_

PDB Entry: 3grc, 2.21 Å

PDB Description: crystal structure of a sensor protein from polaromonas sp. js666

PDB Compounds: (C:) Sensor protein, Kinase

SCOPe Domain Sequences for d3grcc_:

Sequence; same for both SEQRES and ATOM records:

>d3grcc_ c.23.1.0 (C:) automated matches {Polaromonas sp. [TaxId: 296591]}
prpriliceddpdiarllnlmlekggfdsdmvhsaaqaleqvarrpyaamtvdlnlpdqd
gvsliralrrdsrtrdlaivvvsanaregelefnsqplavstwlekpidenllilslhra
idnma

Timeline for d3grcc_:

• d3grcc_ first appeared in SCOPe 2.03
  
• d3grcc_ appears in SCOPe 2.05
  
• d3grcc_ appears in SCOPe 2.07
  
• d3grcc_ appears in the current release, SCOPe 2.08