Lineage for d3gqtc1 (3gqt C:4-242)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1451317Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 1451318Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 1451455Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 1451456Protein automated matches [226934] (14 species)
    not a true protein
  7. 1451468Species Burkholderia pseudomallei [TaxId:320372] [225462] (6 PDB entries)
  8. 1451475Domain d3gqtc1: 3gqt C:4-242 [210636]
    Other proteins in same PDB: d3gqta2, d3gqtb2, d3gqtc2, d3gqtd2
    automated match to d1siqa2
    complexed with ufo

Details for d3gqtc1

PDB Entry: 3gqt (more details), 1.99 Å

PDB Description: Crystal structure of glutaryl-CoA dehydrogenase from Burkholderia pseudomallei with fragment (1,4-dimethyl-1,2,3,4-tetrahydroquinoxalin-6-yl)methylamine
PDB Compounds: (C:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d3gqtc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gqtc1 e.6.1.0 (C:4-242) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
lpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspiadvfvvwa
kldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkg

SCOPe Domain Coordinates for d3gqtc1:

Click to download the PDB-style file with coordinates for d3gqtc1.
(The format of our PDB-style files is described here.)

Timeline for d3gqtc1: