Lineage for d3gnml1 (3gnm L:1-112)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024733Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries)
  8. 2024780Domain d3gnml1: 3gnm L:1-112 [210617]
    Other proteins in same PDB: d3gnml2
    automated match to d1blna1
    complexed with 1pe, edo

Details for d3gnml1

PDB Entry: 3gnm (more details), 2.1 Å

PDB Description: The crystal structure of the JAA-F11 monoclonal antibody Fab fragment
PDB Compounds: (L:) JAA-F11 Fab Antibody Fragment, Light Chain

SCOPe Domain Sequences for d3gnml1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gnml1 b.1.1.1 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evlmtqtplslpvnlgdqasiscrssqtivysngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaddlgvyycfqgshvpftfgsgtkleik

SCOPe Domain Coordinates for d3gnml1:

Click to download the PDB-style file with coordinates for d3gnml1.
(The format of our PDB-style files is described here.)

Timeline for d3gnml1: