SCOPe 2.04: Domain d3gncc1: 3gnc C:4-242

Lineage for d3gncc1 (3gnc C:4-242)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.0: automated matches [227203] (1 protein)
   not a true family

6. Protein automated matches [226934] (17 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:320372] [225462] (6 PDB entries)

8. Domain d3gncc1: 3gnc C:4-242 [210613]
   Other proteins in same PDB: d3gnca2, d3gncb2, d3gncc2, d3gncd2
   automated match to d1siqa2
   complexed with epe, qqq, so4

Details for d3gncc1

PDB Entry: 3gnc, 2.15 Å

PDB Description: Crystal structure of Glutaryl-COA dehydrogenase from Burkholderia Pseudomallei with fragment 6421

PDB Compounds: (C:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d3gncc1:

Sequence, based on SEQRES records:

>d3gncc1 e.6.1.0 (C:4-242) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
lpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspiadvfvvwa
kldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkg

Sequence, based on observed residues (ATOM records):

>d3gncc1 e.6.1.0 (C:4-242) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
lpklatgewigcfgltepngsmvtrarkvpggyslsgskmwitnspiadvfvvwaklded
grdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkg

Timeline for d3gncc1:

• d3gncc1 first appeared in SCOPe 2.03
  
• d3gncc1 appears in SCOPe 2.05
  
• d3gncc1 appears in the current release, SCOPe 2.08