SCOP 1.73: Domain d2gfbp2: 2gfb P:120-227

Lineage for d2gfbp2 (2gfb P:120-227)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d2gfbp2: 2gfb P:120-227 [21061]
   Other proteins in same PDB: d2gfba1, d2gfba2, d2gfbb1, d2gfbc1, d2gfbc2, d2gfbd1, d2gfbe1, d2gfbe2, d2gfbf1, d2gfbg1, d2gfbg2, d2gfbh1, d2gfbi1, d2gfbi2, d2gfbj1, d2gfbk1, d2gfbk2, d2gfbl1, d2gfbm1, d2gfbm2, d2gfbn1, d2gfbo1, d2gfbo2, d2gfbp1
   part of Fab CNJ206; H-chains in this entry seem to be mistraced in VH region

Details for d2gfbp2

PDB Entry: 2gfb, 3 Å

PDB Description: crystal structure of a catalytic fab having esterase-like activity

PDB Compounds: (P:) igg2a cnj206 fab (heavy chain)

SCOP Domain Sequences for d2gfbp2:

Sequence; same for both SEQRES and ATOM records:

>d2gfbp2 b.1.1.2 (P:120-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
svyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss
svtvtsstwpsqsitcnvahpasstkvdkkieprg

Timeline for d2gfbp2:

• d2gfbp2 first appeared (with stable ids) in SCOP 1.55
  
• d2gfbp2 appears in SCOP 1.71
  
• d2gfbp2 appears in SCOP 1.75
  
• d2gfbp2 appears in the current release, SCOPe 2.08