Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (64 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225411] (5 PDB entries) |
Domain d3gl1a2: 3gl1 A:192-384 [210573] automated match to d1ngfa2 complexed with cl, gol, mg |
PDB Entry: 3gl1 (more details), 1.92 Å
SCOPe Domain Sequences for d3gl1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gl1a2 c.55.1.0 (A:192-384) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sekerhvlifdlgggtfdvsllhiaggvytvkstsgnthlggqdfdtnllehfkaefkkk tgldisddaralrrlrtaaerakrtlssvtqttvevdslfdgedfessltrarfedlnaa lfkstlepveqvlkdakisksqidevvlvggstripkvqkllsdffdgkqleksinpdea vaygaavqgailt
Timeline for d3gl1a2: